PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.KTL6D
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 59aa    MW: 6826.86 Da    PI: 4.6017
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.KTL6DgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM514.8e-161056148
          NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                 lppGfrF P+deelv +yL kk++++++    ++ e+d++++ePw+Lp
  Araip.KTL6D 10 LPPGFRFYPSDEELVLHYLYKKITNEEVLK-GTLMEIDLHTCEPWQLP 56
                 79************************9655.78**************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.06E-17859IPR003441NAC domain
PROSITE profilePS5100520.1911059IPR003441NAC domain
PfamPF023653.2E-81153IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 59 aa     Download sequence    Send to blast
MGLRDIGASL PPGFRFYPSD EELVLHYLYK KITNEEVLKG TLMEIDLHTC EPWQLPGTY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006588681.17e-36PREDICTED: NAC domain-containing protein 21/22-like
SwissprotQ9FFI51e-16NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A0B2P9H48e-36A0A0B2P9H4_GLYSO; NAC domain-containing protein 21/22
TrEMBLI1L8E78e-36I1L8E7_SOYBN; Uncharacterized protein
STRINGGLYMA10G04350.12e-35(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1720277
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.24e-21NAC domain containing protein 74